PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010091727.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family G2-like
Protein Properties Length: 135aa    MW: 15359.3 Da    PI: 6.1074
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010091727.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like54.42.8e-1770119151
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                     k++l Wt eLH++F++a ++L G + A  k+i  lm+  gLt e+v SHLQ
  XP_010091727.1  70 KTKLIWTDELHNKFLQATNEL-GFDGAYSKEIHLLMNASGLTKENVSSHLQ 119
                     6899*****************.9**************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.15E-1268123IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.3E-1869119IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-1570123IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 135 aa     Download sequence    Send to blast
MFVIFEEPYI LGRSFYSGSL QENAVNEDLE SRVSVNVTNH QRKKRVSQAG DAATYQKVEE  60
ENDDSTALSK TKLIWTDELH NKFLQATNEL GFDGAYSKEI HLLMNASGLT KENVSSHLQV  120
RFLLKLSLKP YVSFI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010091727.12e-96hypothetical protein L484_019315
TrEMBLW9QWN12e-96W9QWN1_9R
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.13e-16response regulator 2